Lineage for d1homa_ (1hom A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691780Protein Antennapedia Homeodomain [46716] (1 species)
  7. 2691781Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)
  8. 2691787Domain d1homa_: 1hom A: [16007]

Details for d1homa_

PDB Entry: 1hom (more details)

PDB Description: determination of the three-dimensional structure of the antennapedia homeodomain from drosophila in solution by 1h nuclear magnetic resonance spectroscopy
PDB Compounds: (A:) antennapedia protein

SCOPe Domain Sequences for d1homa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1homa_ a.4.1.1 (A:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalclterqikiwfqnrrmkwkke
nktkgepg

SCOPe Domain Coordinates for d1homa_:

Click to download the PDB-style file with coordinates for d1homa_.
(The format of our PDB-style files is described here.)

Timeline for d1homa_: