Lineage for d1ahdp1 (1ahd P:1-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304503Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 2304504Protein Antennapedia Homeodomain [46716] (1 species)
  7. 2304505Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)
  8. 2304508Domain d1ahdp1: 1ahd P:1-67 [16006]
    Other proteins in same PDB: d1ahdp2
    protein/DNA complex

Details for d1ahdp1

PDB Entry: 1ahd (more details)

PDB Description: determination of the nmr solution structure of an antennapedia homeodomain-dna complex
PDB Compounds: (P:) Homeotic protein antennapedia

SCOPe Domain Sequences for d1ahdp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahdp1 a.4.1.1 (P:1-67) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken
ktkgepg

SCOPe Domain Coordinates for d1ahdp1:

Click to download the PDB-style file with coordinates for d1ahdp1.
(The format of our PDB-style files is described here.)

Timeline for d1ahdp1: