Lineage for d9antb_ (9ant B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691780Protein Antennapedia Homeodomain [46716] (1 species)
  7. 2691781Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)
  8. 2691783Domain d9antb_: 9ant B: [16005]
    protein/DNA complex; complexed with ni

Details for d9antb_

PDB Entry: 9ant (more details), 2.4 Å

PDB Description: antennapedia homeodomain-dna complex
PDB Compounds: (B:) antennapedia homeodomain

SCOPe Domain Sequences for d9antb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d9antb_ a.4.1.1 (B:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken

SCOPe Domain Coordinates for d9antb_:

Click to download the PDB-style file with coordinates for d9antb_.
(The format of our PDB-style files is described here.)

Timeline for d9antb_: