SCOPe 2.08: Domain d9anta_: 9ant A:

Lineage for d9anta_ (9ant A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Antennapedia Homeodomain [46716] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)

8. Domain d9anta_: 9ant A: [16004]
   protein/DNA complex; complexed with ni

Details for d9anta_

PDB Entry: 9ant, 2.4 Å

PDB Description: antennapedia homeodomain-dna complex

PDB Compounds: (A:) antennapedia homeodomain

SCOPe Domain Sequences for d9anta_:

Sequence; same for both SEQRES and ATOM records:

>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken

Timeline for d9anta_:

• d9anta_ first appeared (with stable ids) in SCOP 1.55
  
• d9anta_ appears in SCOPe 2.07