Lineage for d1bw5__ (1bw5 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1254Protein Insulin gene enhancer protein isl-1 [46714] (1 species)
  7. 1255Species Rat (Rattus norvegicus) [TaxId:10116] [46715] (1 PDB entry)
  8. 1256Domain d1bw5__: 1bw5 - [16003]

Details for d1bw5__

PDB Entry: 1bw5 (more details)

PDB Description: the nmr solution structure of the homeodomain of the rat insulin gene enhancer protein isl-1, 50 structures

SCOP Domain Sequences for d1bw5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw5__ a.4.1.1 (-) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus)}
mkttrvrtvlnekqlhtlrtcyaanprpdalmkeqlvemtglsprvirvwfqnkrckdkk
rsimmk

SCOP Domain Coordinates for d1bw5__:

Click to download the PDB-style file with coordinates for d1bw5__.
(The format of our PDB-style files is described here.)

Timeline for d1bw5__: