SCOPe 2.08: Domain d1du6a1: 1du6 A:8-64

Lineage for d1du6a1 (1du6 A:8-64)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein pbx1 [46711] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46713] (2 PDB entries)

8. Domain d1du6a1: 1du6 A:8-64 [16002]
   Other proteins in same PDB: d1du6a2

Details for d1du6a1

PDB Entry: 1du6

PDB Description: solution structure of the truncated pbx homeodomain

PDB Compounds: (A:) homeobox protein pbx1

SCOPe Domain Sequences for d1du6a1:

Sequence; same for both SEQRES and ATOM records:

>d1du6a1 a.4.1.1 (A:8-64) pbx1 {Mouse (Mus musculus) [TaxId: 10090]}
rhmnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrirykkn

Timeline for d1du6a1:

• d1du6a1 first appeared (with stable ids) in SCOP 1.55, called d1du6a_
  
• d1du6a1 appears in SCOPe 2.07