Lineage for d1du6a1 (1du6 A:8-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691929Protein pbx1 [46711] (2 species)
  7. 2691933Species Mouse (Mus musculus) [TaxId:10090] [46713] (2 PDB entries)
  8. 2691935Domain d1du6a1: 1du6 A:8-64 [16002]
    Other proteins in same PDB: d1du6a2

Details for d1du6a1

PDB Entry: 1du6 (more details)

PDB Description: solution structure of the truncated pbx homeodomain
PDB Compounds: (A:) homeobox protein pbx1

SCOPe Domain Sequences for d1du6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du6a1 a.4.1.1 (A:8-64) pbx1 {Mouse (Mus musculus) [TaxId: 10090]}
rhmnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrirykkn

SCOPe Domain Coordinates for d1du6a1:

Click to download the PDB-style file with coordinates for d1du6a1.
(The format of our PDB-style files is described here.)

Timeline for d1du6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1du6a2