Lineage for d1b72b_ (1b72 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1287Protein pbx1 [46711] (2 species)
  7. 1288Species Human (Homo sapiens) [TaxId:9606] [46712] (1 PDB entry)
  8. 1289Domain d1b72b_: 1b72 B: [16001]
    Other proteins in same PDB: d1b72a_

Details for d1b72b_

PDB Entry: 1b72 (more details), 2.35 Å

PDB Description: pbx1, homeobox protein hox-b1/dna ternary complex

SCOP Domain Sequences for d1b72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b72b_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens)}
rkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrirykkn
igkfqeeaniyaa

SCOP Domain Coordinates for d1b72b_:

Click to download the PDB-style file with coordinates for d1b72b_.
(The format of our PDB-style files is described here.)

Timeline for d1b72b_:

1289
d1b72b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1b72a_