Lineage for d1ocpa_ (1ocp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720551Protein Oct-3 POU Homeodomain [46707] (1 species)
  7. 1720552Species Mouse (Mus musculus) [TaxId:10090] [46708] (1 PDB entry)
  8. 1720553Domain d1ocpa_: 1ocp A: [15999]

Details for d1ocpa_

PDB Entry: 1ocp (more details)

PDB Description: solution structure of oct3 pou-homeodomain
PDB Compounds: (A:) oct-3

SCOPe Domain Sequences for d1ocpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]}
metlvqarkrkrtsienrvrwsletmflkcpkpslqqithianqlglekdvvrvwfcnrr
qkgkrss

SCOPe Domain Coordinates for d1ocpa_:

Click to download the PDB-style file with coordinates for d1ocpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ocpa_: