Lineage for d1hdpa_ (1hdp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691915Protein Oct-2 POU Homeodomain [46705] (1 species)
  7. 2691916Species Human (Homo sapiens) [TaxId:9606] [46706] (1 PDB entry)
  8. 2691917Domain d1hdpa_: 1hdp A: [15998]

Details for d1hdpa_

PDB Entry: 1hdp (more details)

PDB Description: solution structure of a pou-specific homeodomain: 3d-nmr studies of human b-cell transcription factor oct-2
PDB Compounds: (A:) oct-2 pou homeodomain

SCOPe Domain Sequences for d1hdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdpa_ a.4.1.1 (A:) Oct-2 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
rrkkrtsietnvrfaleksflanqkptseeilliaeqlhmekevirvwfcnrrqkekrin
pcs

SCOPe Domain Coordinates for d1hdpa_:

Click to download the PDB-style file with coordinates for d1hdpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hdpa_: