Lineage for d1ftt__ (1ftt -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1296Protein Thyroid transcription factor 1 homeodomain [46703] (1 species)
  7. 1297Species Rat (Rattus norvegicus) [TaxId:10116] [46704] (1 PDB entry)
  8. 1298Domain d1ftt__: 1ftt - [15997]

Details for d1ftt__

PDB Entry: 1ftt (more details)

PDB Description: thyroid transcription factor 1 homeodomain (rattus norvegicus)

SCOP Domain Sequences for d1ftt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftt__ a.4.1.1 (-) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus)}
mrrkrrvlfsqaqvyelerrfkqqkylsaperehlasmihltptqvkiwfqnhrykmkrq
akdkaaqq

SCOP Domain Coordinates for d1ftt__:

Click to download the PDB-style file with coordinates for d1ftt__.
(The format of our PDB-style files is described here.)

Timeline for d1ftt__: