Lineage for d1ftta_ (1ftt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981149Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 1981313Protein Thyroid transcription factor 1 homeodomain [46703] (1 species)
  7. 1981314Species Norway rat (Rattus norvegicus) [TaxId:10116] [46704] (1 PDB entry)
  8. 1981315Domain d1ftta_: 1ftt A: [15997]

Details for d1ftta_

PDB Entry: 1ftt (more details)

PDB Description: thyroid transcription factor 1 homeodomain (rattus norvegicus)
PDB Compounds: (A:) thyroid transcription factor 1 homeodomain

SCOPe Domain Sequences for d1ftta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mrrkrrvlfsqaqvyelerrfkqqkylsaperehlasmihltptqvkiwfqnhrykmkrq
akdkaaqq

SCOPe Domain Coordinates for d1ftta_:

Click to download the PDB-style file with coordinates for d1ftta_.
(The format of our PDB-style files is described here.)

Timeline for d1ftta_: