Lineage for d1au7b1 (1au7 B:103-160)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1292Protein Pit-1 POU homeodomain [46701] (1 species)
  7. 1293Species Rat (Rattus norvegicus) [TaxId:10116] [46702] (1 PDB entry)
  8. 1295Domain d1au7b1: 1au7 B:103-160 [15996]
    Other proteins in same PDB: d1au7a2, d1au7b2

Details for d1au7b1

PDB Entry: 1au7 (more details), 2.3 Å

PDB Description: pit-1 mutant/dna complex

SCOP Domain Sequences for d1au7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au7b1 a.4.1.1 (B:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus)}
krrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnrrqrekrvk

SCOP Domain Coordinates for d1au7b1:

Click to download the PDB-style file with coordinates for d1au7b1.
(The format of our PDB-style files is described here.)

Timeline for d1au7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1au7b2