Lineage for d1au7b1 (1au7 B:103-160)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. Protein Pit-1 POU homeodomain [46701] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [46702] (1 PDB entry)
  8. Domain d1au7b1: 1au7 B:103-160 [15996]
    Other proteins in same PDB: d1au7a2, d1au7b2
    protein/DNA complex; mutant

Details for d1au7b1

PDB Entry: 1au7 (more details), 2.3 Å

PDB Description: pit-1 mutant/dna complex
PDB Compounds: (B:) protein pit-1

SCOPe Domain Sequences for d1au7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au7b1 a.4.1.1 (B:103-160) Pit-1 POU homeodomain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnrrqrekrvk

SCOPe Domain Coordinates for d1au7b1 are not available.

Timeline for d1au7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1au7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1au7a1, d1au7a2