SCOPe 2.07: Domain d1au7a1: 1au7 A:103-160

Lineage for d1au7a1 (1au7 A:103-160)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Pit-1 POU homeodomain [46701] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [46702] (1 PDB entry)

8. Domain d1au7a1: 1au7 A:103-160 [15995]
   Other proteins in same PDB: d1au7a2, d1au7b2
   protein/DNA complex; mutant

Details for d1au7a1

PDB Entry: 1au7, 2.3 Å

PDB Description: pit-1 mutant/dna complex

PDB Compounds: (A:) protein pit-1

SCOPe Domain Sequences for d1au7a1:

Sequence; same for both SEQRES and ATOM records:

>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnrrqrekrvk

Timeline for d1au7a1:

• d1au7a1 first appeared (with stable ids) in SCOP 1.55
  
• d1au7a1 appears in SCOPe 2.06
  
• d1au7a1 appears in the current release, SCOPe 2.08