![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Pit-1 POU homeodomain [46701] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [46702] (1 PDB entry) |
![]() | Domain d1au7a1: 1au7 A:103-160 [15995] Other proteins in same PDB: d1au7a2, d1au7b2 protein/DNA complex; mutant |
PDB Entry: 1au7 (more details), 2.3 Å
SCOPe Domain Sequences for d1au7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Norway rat (Rattus norvegicus) [TaxId: 10116]} krrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnrrqrekrvk
Timeline for d1au7a1: