Lineage for d1au7a1 (1au7 A:103-160)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691936Protein Pit-1 POU homeodomain [46701] (1 species)
  7. 2691937Species Norway rat (Rattus norvegicus) [TaxId:10116] [46702] (1 PDB entry)
  8. 2691938Domain d1au7a1: 1au7 A:103-160 [15995]
    Other proteins in same PDB: d1au7a2, d1au7b2
    protein/DNA complex; mutant

Details for d1au7a1

PDB Entry: 1au7 (more details), 2.3 Å

PDB Description: pit-1 mutant/dna complex
PDB Compounds: (A:) protein pit-1

SCOPe Domain Sequences for d1au7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krrttisiaakdalerhfgehskpssqeimrmaeelnlekevvrvwfcnrrqrekrvk

SCOPe Domain Coordinates for d1au7a1:

Click to download the PDB-style file with coordinates for d1au7a1.
(The format of our PDB-style files is described here.)

Timeline for d1au7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1au7a2