Lineage for d1pog__ (1pog -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438101Family a.4.1.1: Homeodomain [46690] (23 proteins)
  6. 438185Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 438186Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 438195Domain d1pog__: 1pog - [15994]

Details for d1pog__

PDB Entry: 1pog (more details)

PDB Description: solution structure of the oct-1 pou-homeo domain determined by nmr and restrained molecular dynamics

SCOP Domain Sequences for d1pog__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pog__ a.4.1.1 (-) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekri
di

SCOP Domain Coordinates for d1pog__:

Click to download the PDB-style file with coordinates for d1pog__.
(The format of our PDB-style files is described here.)

Timeline for d1pog__: