Lineage for d1pog__ (1pog -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45284Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 45336Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 45337Species Human (Homo sapiens) [TaxId:9606] [46700] (4 PDB entries)
  8. 45342Domain d1pog__: 1pog - [15994]

Details for d1pog__

PDB Entry: 1pog (more details)

PDB Description: solution structure of the oct-1 pou-homeo domain determined by nmr and restrained molecular dynamics

SCOP Domain Sequences for d1pog__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pog__ a.4.1.1 (-) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekri
di

SCOP Domain Coordinates for d1pog__:

Click to download the PDB-style file with coordinates for d1pog__.
(The format of our PDB-style files is described here.)

Timeline for d1pog__: