SCOPe 2.08: Domain d1poga1: 1pog A:1-60

Lineage for d1poga1 (1pog A:1-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1poga1: 1pog A:1-60 [15994]
   Other proteins in same PDB: d1poga2

Details for d1poga1

PDB Entry: 1pog

PDB Description: solution structure of the oct-1 pou-homeo domain determined by nmr and restrained molecular dynamics

PDB Compounds: (A:) oct-1 pou homeodomain DNA-binding protein

SCOPe Domain Sequences for d1poga1:

Sequence; same for both SEQRES and ATOM records:

>d1poga1 a.4.1.1 (A:1-60) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
rrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekri

Timeline for d1poga1:

• d1poga1 first appeared (with stable ids) in SCOP 1.55, called d1pog__
  
• d1poga1 was called d1poga_ in SCOPe 2.07