Lineage for d1cqtb1 (1cqt B:602-661)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 149794Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 149848Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 149849Species Human (Homo sapiens) [TaxId:9606] [46700] (5 PDB entries)
  8. 149855Domain d1cqtb1: 1cqt B:602-661 [15993]
    Other proteins in same PDB: d1cqta2, d1cqtb2

Details for d1cqtb1

PDB Entry: 1cqt (more details), 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element

SCOP Domain Sequences for d1cqtb1:

Sequence, based on SEQRES records: (download)

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

Sequence, based on observed residues (ATOM records): (download)

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqktseeitmiadqlnmekevirvwfcnrrqkekrinp

SCOP Domain Coordinates for d1cqtb1:

Click to download the PDB-style file with coordinates for d1cqtb1.
(The format of our PDB-style files is described here.)

Timeline for d1cqtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqtb2