Lineage for d1cqta1 (1cqt A:102-161)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 149794Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 149848Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 149849Species Human (Homo sapiens) [TaxId:9606] [46700] (5 PDB entries)
  8. 149854Domain d1cqta1: 1cqt A:102-161 [15992]
    Other proteins in same PDB: d1cqta2, d1cqtb2

Details for d1cqta1

PDB Entry: 1cqt (more details), 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element

SCOP Domain Sequences for d1cqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqta1 a.4.1.1 (A:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

SCOP Domain Coordinates for d1cqta1:

Click to download the PDB-style file with coordinates for d1cqta1.
(The format of our PDB-style files is described here.)

Timeline for d1cqta1:

149854
d1cqta1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1cqta2