| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (21 proteins) |
| Protein Oct-1 POU Homeodomain [46699] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46700] (6 PDB entries) |
| Domain d1octc1: 1oct C:102-161 [15991] Other proteins in same PDB: d1octc2 protein/DNA complex |
PDB Entry: 1oct (more details), 3 Å
SCOP Domain Sequences for d1octc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1octc1 a.4.1.1 (C:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
Timeline for d1octc1: