SCOP 1.59: Domain d1octc1: 1oct C:102-161

Lineage for d1octc1 (1oct C:102-161)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (5 PDB entries)

8. Domain d1octc1: 1oct C:102-161 [15991]
   Other proteins in same PDB: d1octc2

Details for d1octc1

PDB Entry: 1oct, 3 Å

PDB Description: crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules

SCOP Domain Sequences for d1octc1:

Sequence; same for both SEQRES and ATOM records:

>d1octc1 a.4.1.1 (C:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

Timeline for d1octc1:

• d1octc1 first appeared (with stable ids) in SCOP 1.55
  
• d1octc1 appears in SCOP 1.57
  
• d1octc1 appears in SCOP 1.61
  
• d1octc1 appears in the current release, SCOPe 2.08