Lineage for d1octc1 (1oct C:102-161)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1270Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 1271Species Human (Homo sapiens) [TaxId:9606] [46700] (3 PDB entries)
  8. 1272Domain d1octc1: 1oct C:102-161 [15991]
    Other proteins in same PDB: d1octc2

Details for d1octc1

PDB Entry: 1oct (more details), 3 Å

PDB Description: crystal structure of the oct-1 pou domain bound to an octamer site: dna recognition with tethered dna-binding modules

SCOP Domain Sequences for d1octc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1octc1 a.4.1.1 (C:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

SCOP Domain Coordinates for d1octc1:

Click to download the PDB-style file with coordinates for d1octc1.
(The format of our PDB-style files is described here.)

Timeline for d1octc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1octc2