![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species) atypical Homeodomain with a large insertion into HTH motif |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [46698] (2 PDB entries) |
![]() | Domain d2lfba_: 2lfb A: [15990] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2lfb (more details)
SCOPe Domain Sequences for d2lfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} maridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvsps qaqglgsnlvtevrvynwfanrrkeeafrhklamdtykln
Timeline for d2lfba_: