SCOPe 2.08: Domain d2lfba_: 2lfb A:

Lineage for d2lfba_ (2lfb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species)
   atypical Homeodomain with a large insertion into HTH motif

7. Species Rat (Rattus rattus) [TaxId:10117] [46698] (2 PDB entries)

8. Domain d2lfba_: 2lfb A: [15990]
   has additional insertions and/or extensions that are not grouped together

Details for d2lfba_

PDB Entry: 2lfb

PDB Description: homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures

PDB Compounds: (A:) lfb1/hnf1 transcription factor

SCOPe Domain Sequences for d2lfba_:

Sequence; same for both SEQRES and ATOM records:

>d2lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]}
maridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvsps
qaqglgsnlvtevrvynwfanrrkeeafrhklamdtykln

Timeline for d2lfba_:

• d2lfba_ first appeared (with stable ids) in SCOP 1.55, called d2lfb__
  
• d2lfba_ appears in SCOPe 2.07