Lineage for d1apld_ (1apl D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1257Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 1258Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (4 PDB entries)
  8. 1264Domain d1apld_: 1apl D: [15988]

Details for d1apld_

PDB Entry: 1apl (more details), 2.7 Å

PDB Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-dna interactions

SCOP Domain Sequences for d1apld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apld_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt

SCOP Domain Coordinates for d1apld_:

Click to download the PDB-style file with coordinates for d1apld_.
(The format of our PDB-style files is described here.)

Timeline for d1apld_:

1264
d1apld_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1aplc_