Lineage for d1aplc_ (1apl C:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (10 families) 
Family a.4.1.1: Homeodomain [46690] (20 proteins) 
Protein mat alpha2 Homeodomain [46695] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (4 PDB entries) 
Domain d1aplc_: 1apl C: [15987]
Details for d1aplc_
PDB Entry: 1apl (more details), 2.7 Å
PDB Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-dna interactions
SCOP Domain Sequences for d1aplc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aplc_ a.4.1.1 (C:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
SCOP Domain Coordinates for d1aplc_:
Click to download the PDB-style file with coordinates for d1aplc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aplc_:
View in 3D
