SCOPe 2.06: Domain d1yrnb_: 1yrn B:

Lineage for d1yrnb_ (1yrn B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)

8. Domain d1yrnb_: 1yrn B: [15986]
   Other proteins in same PDB: d1yrna_
   protein/DNA complex

Details for d1yrnb_

PDB Entry: 1yrn, 2.5 Å

PDB Description: crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna

PDB Compounds: (B:) protein (mat alpha2 homeodomain)

SCOPe Domain Sequences for d1yrnb_:

Sequence; same for both SEQRES and ATOM records:

>d1yrnb_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
ktitiapeladllsgepl

Timeline for d1yrnb_:

• d1yrnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yrnb_ appears in SCOPe 2.05
  
• d1yrnb_ appears in SCOPe 2.07
  
• d1yrnb_ appears in the current release, SCOPe 2.08