Lineage for d1akhb_ (1akh B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 94902Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 94938Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 94939Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (4 PDB entries)
  8. 94942Domain d1akhb_: 1akh B: [15985]
    Other proteins in same PDB: d1akha_

Details for d1akhb_

PDB Entry: 1akh (more details), 2.5 Å

PDB Description: mat a1/alpha2/dna ternary complex

SCOP Domain Sequences for d1akhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akhb_ a.4.1.1 (B:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
ktitiapeladllsgepl

SCOP Domain Coordinates for d1akhb_:

Click to download the PDB-style file with coordinates for d1akhb_.
(The format of our PDB-style files is described here.)

Timeline for d1akhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1akha_