Lineage for d1mnmc_ (1mnm C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45284Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 45320Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 45321Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (4 PDB entries)
  8. 45322Domain d1mnmc_: 1mnm C: [15983]
    Other proteins in same PDB: d1mnma_, d1mnmb_

Details for d1mnmc_

PDB Entry: 1mnm (more details), 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure

SCOP Domain Sequences for d1mnmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnmc_ a.4.1.1 (C:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
riqiknwvsnrrrkekt

SCOP Domain Coordinates for d1mnmc_:

Click to download the PDB-style file with coordinates for d1mnmc_.
(The format of our PDB-style files is described here.)

Timeline for d1mnmc_: