Lineage for d1f43a_ (1f43 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1265Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 1266Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (3 PDB entries)
  8. 1269Domain d1f43a_: 1f43 A: [15982]

Details for d1f43a_

PDB Entry: 1f43 (more details)

PDB Description: solution structure of the mata1 homeodomain

SCOP Domain Sequences for d1f43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f43a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k

SCOP Domain Coordinates for d1f43a_:

Click to download the PDB-style file with coordinates for d1f43a_.
(The format of our PDB-style files is described here.)

Timeline for d1f43a_: