Lineage for d1f43a_ (1f43 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein Mating type protein A1 Homeodomain [46693] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (3 PDB entries) 
Domain d1f43a_: 1f43 A: [15982]
Details for d1f43a_
PDB Entry: 1f43 (more details)
PDB Description: solution structure of the mata1 homeodomain
SCOP Domain Sequences for d1f43a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f43a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k
SCOP Domain Coordinates for d1f43a_:
Click to download the PDB-style file with coordinates for d1f43a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f43a_:
- d1f43a_ appears in SCOP 1.57
- d1f43a_ appears in the current release, SCOPe 2.08
View in 3D