Lineage for d1f43a_ (1f43 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691893Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 2691894Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)
  8. 2691898Domain d1f43a_: 1f43 A: [15982]

Details for d1f43a_

PDB Entry: 1f43 (more details)

PDB Description: solution structure of the mata1 homeodomain
PDB Compounds: (A:) mating-type protein a-1

SCOPe Domain Sequences for d1f43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f43a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
k

SCOPe Domain Coordinates for d1f43a_:

Click to download the PDB-style file with coordinates for d1f43a_.
(The format of our PDB-style files is described here.)

Timeline for d1f43a_: