Lineage for d1yrna_ (1yrn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981565Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1981679Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 1981680Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)
  8. 1981683Domain d1yrna_: 1yrn A: [15981]
    Other proteins in same PDB: d1yrnb_
    protein/DNA complex

Details for d1yrna_

PDB Entry: 1yrn (more details), 2.5 Å

PDB Description: crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna
PDB Compounds: (A:) protein (mat a1 homeodomain)

SCOPe Domain Sequences for d1yrna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrna_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs

SCOPe Domain Coordinates for d1yrna_:

Click to download the PDB-style file with coordinates for d1yrna_.
(The format of our PDB-style files is described here.)

Timeline for d1yrna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrnb_