Lineage for d1yrna_ (1yrn A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45284Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 45328Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 45329Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (3 PDB entries)
  8. 45331Domain d1yrna_: 1yrn A: [15981]
    Other proteins in same PDB: d1yrnb_

Details for d1yrna_

PDB Entry: 1yrn (more details), 2.5 Å

PDB Description: crystal structure of the mata1/matalpha2 homeodomain heterodimer bound to dna

SCOP Domain Sequences for d1yrna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrna_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
ispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs

SCOP Domain Coordinates for d1yrna_:

Click to download the PDB-style file with coordinates for d1yrna_.
(The format of our PDB-style files is described here.)

Timeline for d1yrna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrnb_