Lineage for d1hddd_ (1hdd D:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein Engrailed Homeodomain [46691] (1 species) Species Drosophila melanogaster [TaxId:7227] [46692] (5 PDB entries) 
Domain d1hddd_: 1hdd D: [15979]
Details for d1hddd_
PDB Entry: 1hdd (more details), 2.8 Å
PDB Description: crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
SCOP Domain Sequences for d1hddd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hddd_ a.4.1.1 (D:) Engrailed Homeodomain {Drosophila melanogaster}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
SCOP Domain Coordinates for d1hddd_:
Click to download the PDB-style file with coordinates for d1hddd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hddd_:
- d1hddd_ appears in SCOP 1.57
- d1hddd_ appears in the current release, SCOPe 2.08
View in 3D
