SCOP 1.57: Domain d1hddc_: 1hdd C:

Lineage for d1hddc_ (1hdd C:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein Engrailed Homeodomain [46691] (1 species)

7. Species Drosophila melanogaster [TaxId:7227] [46692] (5 PDB entries)

8. Domain d1hddc_: 1hdd C: [15978]

Details for d1hddc_

PDB Entry: 1hdd, 2.8 Å

PDB Description: crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions

SCOP Domain Sequences for d1hddc_:

Sequence; same for both SEQRES and ATOM records:

>d1hddc_ a.4.1.1 (C:) Engrailed Homeodomain {Drosophila melanogaster}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks

Timeline for d1hddc_:

• d1hddc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hddc_ appears in SCOP 1.59
  
• d1hddc_ appears in the current release, SCOPe 2.08