SCOPe 2.05: Domain d1du0b_: 1du0 B:

Lineage for d1du0b_ (1du0 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Engrailed Homeodomain [46691] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)

8. Domain d1du0b_: 1du0 B: [15975]
   protein/DNA complex

Details for d1du0b_

PDB Entry: 1du0, 2 Å

PDB Description: engrailed homeodomain q50a variant dna complex

PDB Compounds: (B:) engrailed homeodomain

SCOPe Domain Sequences for d1du0b_:

Sequence; same for both SEQRES and ATOM records:

>d1du0b_ a.4.1.1 (B:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikk

Timeline for d1du0b_:

• d1du0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1du0b_ appears in SCOPe 2.04
  
• d1du0b_ appears in SCOPe 2.06
  
• d1du0b_ appears in the current release, SCOPe 2.08