Lineage for d1du0b_ (1du0 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45283Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 45284Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 45293Protein Engrailed Homeodomain [46691] (1 species)
  7. 45294Species Drosophila melanogaster [TaxId:7227] [46692] (5 PDB entries)
  8. 45299Domain d1du0b_: 1du0 B: [15975]

Details for d1du0b_

PDB Entry: 1du0 (more details), 2 Å

PDB Description: engrailed homeodomain q50a variant dna complex

SCOP Domain Sequences for d1du0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du0b_ a.4.1.1 (B:) Engrailed Homeodomain {Drosophila melanogaster}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikk

SCOP Domain Coordinates for d1du0b_:

Click to download the PDB-style file with coordinates for d1du0b_.
(The format of our PDB-style files is described here.)

Timeline for d1du0b_:

45299
d1du0b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1du0a_