SCOPe 2.06: Domain d1fcdc2: 1fcd C:81-174

Lineage for d1fcdc2 (1fcd C:81-174)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)

7. Species Chromatium vinosum [TaxId:1049] [46684] (1 PDB entry)

8. Domain d1fcdc2: 1fcd C:81-174 [15967]
   Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3
   complexed with fad, hem

Details for d1fcdc2

PDB Entry: 1fcd, 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

PDB Compounds: (C:) flavocytochrome c sulfide dehydrogenase (cytochrome subunit)

SCOPe Domain Sequences for d1fcdc2:

Sequence; same for both SEQRES and ATOM records:

>d1fcdc2 a.3.1.4 (C:81-174) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Chromatium vinosum [TaxId: 1049]}
akqsfdtaladtgaklhdkycekchveggkpladeedyhilagqwtpylqyamsdfreer
rpmekkmasklrellkaegdagldalfafyasqq

Timeline for d1fcdc2:

• d1fcdc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fcdc2 appears in SCOPe 2.05
  
• d1fcdc2 appears in SCOPe 2.07
  
• d1fcdc2 appears in the current release, SCOPe 2.08