Lineage for d1etpa2 (1etp A:93-190)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 210188Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
    duplication: consists of two cytochrome c type domains
  6. 210189Protein Cytochrome c4 [46681] (1 species)
  7. 210190Species Pseudomonas stutzeri [TaxId:316] [46682] (1 PDB entry)
  8. 210192Domain d1etpa2: 1etp A:93-190 [15963]

Details for d1etpa2

PDB Entry: 1etp (more details), 2.2 Å

PDB Description: crystal structure of cytochrome c4 from pseudomonas stutzeri

SCOP Domain Sequences for d1etpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etpa2 a.3.1.4 (A:93-190) Cytochrome c4 {Pseudomonas stutzeri}
gyadpalakqgeklfrggkldqgmpactgchapngvgndlagfpklggqhaaytakqltd
fregnrtndgdtmimrgvaaklsnkdiealssyiqglh

SCOP Domain Coordinates for d1etpa2:

Click to download the PDB-style file with coordinates for d1etpa2.
(The format of our PDB-style files is described here.)

Timeline for d1etpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1etpa1