SCOPe 2.08: Domain d1etpa2: 1etp A:93-190

Lineage for d1etpa2 (1etp A:93-190)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Cytochrome c4 [46681] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)

8. Domain d1etpa2: 1etp A:93-190 [15963]
   complexed with hem

Details for d1etpa2

PDB Entry: 1etp, 2.2 Å

PDB Description: crystal structure of cytochrome c4 from pseudomonas stutzeri

PDB Compounds: (A:) cytochrome c4

SCOPe Domain Sequences for d1etpa2:

Sequence; same for both SEQRES and ATOM records:

>d1etpa2 a.3.1.4 (A:93-190) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
gyadpalakqgeklfrggkldqgmpactgchapngvgndlagfpklggqhaaytakqltd
fregnrtndgdtmimrgvaaklsnkdiealssyiqglh

Timeline for d1etpa2:

• d1etpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1etpa2 appears in SCOPe 2.07