Lineage for d3bccd2 (3bcc D:1-195)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981260Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1981261Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1981273Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)
  8. 1981276Domain d3bccd2: 3bcc D:1-195 [15961]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bccd2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus) [TaxId: 9031]}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d3bccd2:

Click to download the PDB-style file with coordinates for d3bccd2.
(The format of our PDB-style files is described here.)

Timeline for d3bccd2: