Lineage for d3bccd2 (3bcc D:1-195)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1195Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 1196Protein Cytochrome bc1 domain [46677] (2 species)
  7. 1197Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)
  8. 1200Domain d3bccd2: 3bcc D:1-195 [15961]
    Other proteins in same PDB: d3bcca_, d3bccb_, d3bccc1, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bccd2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (D:)

SCOP Domain Sequences for d3bccd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus)}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d3bccd2:

Click to download the PDB-style file with coordinates for d3bccd2.
(The format of our PDB-style files is described here.)

Timeline for d3bccd2: