SCOP 1.59: Domain d1e2rb1: 1e2r B:25-135

Lineage for d1e2rb1 (1e2r B:25-135)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)

7. Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries)

8. Domain d1e2rb1: 1e2r B:25-135 [15954]
   Other proteins in same PDB: d1e2ra2, d1e2rb2

Details for d1e2rb1

PDB Entry: 1e2r, 1.59 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound

SCOP Domain Sequences for d1e2rb1:

Sequence; same for both SEQRES and ATOM records:

>d1e2rb1 a.3.1.2 (B:25-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
yepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpd
ltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaapp

Timeline for d1e2rb1:

• d1e2rb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e2rb1 appears in SCOP 1.57
  
• d1e2rb1 appears in SCOP 1.61
  
• d1e2rb1 appears in the current release, SCOPe 2.08