Lineage for d1e2rb1 (1e2r B:25-135)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1162Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 1163Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 1164Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries)
  8. 1168Domain d1e2rb1: 1e2r B:25-135 [15954]
    Other proteins in same PDB: d1e2ra2, d1e2rb2

Details for d1e2rb1

PDB Entry: 1e2r (more details), 1.59 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound

SCOP Domain Sequences for d1e2rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2rb1 a.3.1.2 (B:25-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
yepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpd
ltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaapp

SCOP Domain Coordinates for d1e2rb1:

Click to download the PDB-style file with coordinates for d1e2rb1.
(The format of our PDB-style files is described here.)

Timeline for d1e2rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e2rb2