Lineage for d1e2ra1 (1e2r A:36-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304844Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 2304845Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 2304846Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries)
  8. 2304849Domain d1e2ra1: 1e2r A:36-135 [15953]
    Other proteins in same PDB: d1e2ra2, d1e2rb2
    complexed with cyn, dhe, gol, hec

Details for d1e2ra1

PDB Entry: 1e2r (more details), 1.59 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1e2ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2ra1 a.3.1.2 (A:36-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}
dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
sfityaspagmpnwgtsgelsaeqvdlmanyllldpaapp

SCOPe Domain Coordinates for d1e2ra1:

Click to download the PDB-style file with coordinates for d1e2ra1.
(The format of our PDB-style files is described here.)

Timeline for d1e2ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e2ra2