| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
| Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species) the C-terminal domain is a 8-bladed beta-propeller |
| Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries) |
| Domain d1e2ra1: 1e2r A:36-135 [15953] Other proteins in same PDB: d1e2ra2, d1e2rb2 complexed with cyn, dhe, gol, hec |
PDB Entry: 1e2r (more details), 1.59 Å
SCOPe Domain Sequences for d1e2ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2ra1 a.3.1.2 (A:36-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}
dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
sfityaspagmpnwgtsgelsaeqvdlmanyllldpaapp
Timeline for d1e2ra1: