| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
| Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
| Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries) |
| Domain d1qksb1: 1qks B:9-135 [15952] Other proteins in same PDB: d1qksa2, d1qksb2 complexed with dhe, gol, hec, so4 |
PDB Entry: 1qks (more details), 1.28 Å
SCOP Domain Sequences for d1qksb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qksb1 a.3.1.2 (B:9-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
ldpaapp
Timeline for d1qksb1: