Lineage for d1qksb1 (1qks B:9-135)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 351084Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 351085Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 351086Species Paracoccus denitrificans [TaxId:266] [46675] (2 PDB entries)
  8. 351088Domain d1qksb1: 1qks B:9-135 [15952]
    Other proteins in same PDB: d1qksa2, d1qksb2
    complexed with dhe, gol, hec, so4

Details for d1qksb1

PDB Entry: 1qks (more details), 1.28 Å

PDB Description: cytochrome cd1 nitrite reductase, oxidised form

SCOP Domain Sequences for d1qksb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qksb1 a.3.1.2 (B:9-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
ldpaapp

SCOP Domain Coordinates for d1qksb1:

Click to download the PDB-style file with coordinates for d1qksb1.
(The format of our PDB-style files is described here.)

Timeline for d1qksb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qksb2