SCOP 1.73: Domain d1bl9b1: 1bl9 B:7-117

Lineage for d1bl9b1 (1bl9 B:7-117)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)

8. Domain d1bl9b1: 1bl9 B:7-117 [15948]
   Other proteins in same PDB: d1bl9a2, d1bl9b2
   complexed with dhe, hec, oh

Details for d1bl9b1

PDB Entry: 1bl9, 2.9 Å

PDB Description: conformational changes occurring upon reduction in nitrite reductase from pseudomonas aeruginosa

PDB Compounds: (B:) nitrite reductase

SCOP Domain Sequences for d1bl9b1:

Sequence; same for both SEQRES and ATOM records:

>d1bl9b1 a.3.1.2 (B:7-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
aeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpd
itqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d1bl9b1:

• d1bl9b1 first appeared (with stable ids) in SCOP 1.55
  
• d1bl9b1 appears in SCOP 1.71
  
• d1bl9b1 appears in SCOP 1.75
  
• d1bl9b1 appears in the current release, SCOPe 2.08