Lineage for d1bl9b1 (1bl9 B:7-117)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691393Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 2691394Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 2691425Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)
  8. 2691440Domain d1bl9b1: 1bl9 B:7-117 [15948]
    Other proteins in same PDB: d1bl9a2, d1bl9b2
    complexed with dhe, hec, oh

Details for d1bl9b1

PDB Entry: 1bl9 (more details), 2.9 Å

PDB Description: conformational changes occurring upon reduction in nitrite reductase from pseudomonas aeruginosa
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1bl9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl9b1 a.3.1.2 (B:7-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
aeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpd
itqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOPe Domain Coordinates for d1bl9b1:

Click to download the PDB-style file with coordinates for d1bl9b1.
(The format of our PDB-style files is described here.)

Timeline for d1bl9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bl9b2